PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gh_A05G3650
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family MYB
Protein Properties Length: 234aa    MW: 26075.3 Da    PI: 6.5187
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gh_A05G3650genomeNAU-NBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding59.19.6e-19954147
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                     +g+W+++Ed  l+++v+q+G+++W+ I++ ++ gR++k+c++rw + 
      Gh_A05G3650  9 KGSWSPQEDANLIKLVEQHGPRNWSMISSSIP-GRSGKSCRLRWCNQ 54
                     799*****************************.***********985 PP

2Myb_DNA-binding521.6e-1663105347
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      ++T+ Ed  +++a++ +G++ W+tIar ++ gRt++ +k++w++ 
      Gh_A05G3650  63 PFTAAEDAVIIQAHAVHGNK-WATIARLLP-GRTDNAIKNHWNST 105
                      89******************.*********.***********986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129425.307459IPR017930Myb domain
SuperFamilySSF466891.09E-307102IPR009057Homeodomain-like
SMARTSM007178.0E-16857IPR001005SANT/Myb domain
PfamPF002497.3E-18954IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.1E-241062IPR009057Homeodomain-like
CDDcd001671.06E-141153No hitNo description
SMARTSM007179.7E-1460108IPR001005SANT/Myb domain
PROSITE profilePS5129421.62560110IPR017930Myb domain
Gene3DG3DSA:1.10.10.606.0E-2363109IPR009057Homeodomain-like
PfamPF002491.4E-1363105IPR001005SANT/Myb domain
CDDcd001676.14E-1163106No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 234 aa     Download sequence    Send to blast
MINGGDRVKG SWSPQEDANL IKLVEQHGPR NWSMISSSIP GRSGKSCRLR WCNQLSPAVQ  60
HRPFTAAEDA VIIQAHAVHG NKWATIARLL PGRTDNAIKN HWNSTLRRKR ETELSSGSSE  120
SNSGVKRPSQ DASESESGNK KQCLGLVLQE QEQEQEHENV GMLEPKTLLT LSPPGENMEE  180
EAVVVVVKSE ESGEEKQRAM VDETACLLSI MQRMIKEEVR SYIDKIIADQ NPLK
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1gv2_A1e-3981093104MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJX6146880.0JX614688.1 Gossypium hirsutum clone NBRI_GE58266 microsatellite sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012460624.11e-147PREDICTED: myb-related protein B-like
TrEMBLA0A0D2RZH71e-147A0A0D2RZH7_G
STRINGVIT_13s0067g01360.t014e-88(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM67728135
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G23290.17e-56myb domain protein 70